SCOPe 2.07: Domain d1aoeb_: 1aoe B:

Lineage for d1aoeb_ (1aoe B:)

1. Root: SCOPe 2.07

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.71: Dihydrofolate reductase-like [53596] (1 superfamily)
   3 layers: a/b/a; mixed beta-sheet of 8 strands, order 34251687; strand 8 is antiparallel to the rest

4. Superfamily c.71.1: Dihydrofolate reductase-like [53597] (3 families)

5. Family c.71.1.1: Dihydrofolate reductases [53598] (4 proteins)

6. Protein Dihydrofolate reductases, eukaryotic type [53605] (7 species)

7. Species Yeast (Candida albicans) [TaxId:5476] [53609] (17 PDB entries)

8. Domain d1aoeb_: 1aoe B: [34924]
   complexed with gw3, ndp

Details for d1aoeb_

PDB Entry: 1aoe, 1.6 Å

PDB Description: candida albicans dihydrofolate reductase complexed with dihydro-nicotinamide-adenine-dinucleotide phosphate (nadph) and 1,3-diamino-7-(1-ethyepropye)-7h-pyrralo-[3,2-f]quinazoline (gw345)

PDB Compounds: (B:) dihydrofolate reductase

SCOPe Domain Sequences for d1aoeb_:

Sequence; same for both SEQRES and ATOM records:

>d1aoeb_ c.71.1.1 (B:) Dihydrofolate reductases, eukaryotic type {Yeast (Candida albicans) [TaxId: 5476]}
mlkpnvaiivaalkpalgigykgkmpwrlrkeiryfkdvttrttkpntrnavimgrktwe
sipqkfrplpdrlniilsrsyeneiiddniihassiesslnlvsdvervfiiggaeiyne
linnslvshlliteiehpspesiemdtflkfpleswtkqpkselqkfvgdtvleddikeg
dftynytlwtrk

Timeline for d1aoeb_:

• d1aoeb_ first appeared (with stable ids) in SCOP 1.55
  
• d1aoeb_ appears in SCOPe 2.06
  
• d1aoeb_ appears in the current release, SCOPe 2.08