Lineage for d1aoeb_ (1aoe B:)
- Root: SCOP 1.55
Class c: Alpha and beta proteins (a/b) [51349] (97 folds) 
Fold c.71: Dihydrofolate reductases [53596] (1 superfamily) Superfamily c.71.1: Dihydrofolate reductases [53597] (1 family) 
Family c.71.1.1: Dihydrofolate reductases [53598] (3 proteins) 
Protein Dihydrofolate reductases, eukaryotic type [53605] (4 species) Species Yeast (Candida albicans) [TaxId:5476] [53609] (2 PDB entries) 
Domain d1aoeb_: 1aoe B: [34924]
Details for d1aoeb_
PDB Entry: 1aoe (more details), 1.6 Å
PDB Description: candida albicans dihydrofolate reductase complexed with dihydro-nicotinamide-adenine-dinucleotide phosphate (nadph) and 1,3-diamino-7-(1-ethyepropye)-7h-pyrralo-[3,2-f]quinazoline (gw345)
SCOP Domain Sequences for d1aoeb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1aoeb_ c.71.1.1 (B:) Dihydrofolate reductases, eukaryotic type {Yeast (Candida albicans)}
mlkpnvaiivaalkpalgigykgkmpwrlrkeiryfkdvttrttkpntrnavimgrktwe
sipqkfrplpdrlniilsrsyeneiiddniihassiesslnlvsdvervfiiggaeiyne
linnslvshlliteiehpspesiemdtflkfpleswtkqpkselqkfvgdtvleddikeg
dftynytlwtrk
SCOP Domain Coordinates for d1aoeb_:
Click to download the PDB-style file with coordinates for d1aoeb_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1aoeb_:
- d1aoeb_ appears in SCOP 1.57
- d1aoeb_ appears in the current release, SCOPe 2.08
View in 3D
