SCOPe 2.08: Domain d1daja_: 1daj A:

Lineage for d1daja_ (1daj A:)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.71: Dihydrofolate reductase-like [53596] (1 superfamily)
   3 layers: a/b/a; mixed beta-sheet of 8 strands, order 34251687; strand 8 is antiparallel to the rest

4. Superfamily c.71.1: Dihydrofolate reductase-like [53597] (3 families)

5. Family c.71.1.1: Dihydrofolate reductases [53598] (4 proteins)

6. Protein Dihydrofolate reductases, eukaryotic type [53605] (7 species)

7. Species Fungus (Pneumocystis carinii) [TaxId:4754] [53608] (25 PDB entries)

8. Domain d1daja_: 1daj A: [34921]
   complexed with mot, ndp

Details for d1daja_

PDB Entry: 1daj, 2.3 Å

PDB Description: comparison of ternary complexes of pneumocystis carinii and wild type human dihydrofolate reductase with coenzyme nadph and a novel classical antitumor furo[2,3d]pyrimidine antifolate

PDB Compounds: (A:) dihydrofolate reductase

SCOPe Domain Sequences for d1daja_:

Sequence; same for both SEQRES and ATOM records:

>d1daja_ c.71.1.1 (A:) Dihydrofolate reductases, eukaryotic type {Fungus (Pneumocystis carinii) [TaxId: 4754]}
mnqqksltlivalttsygigrsnslpwklkkeisyfkrvtsfvptfdsfesmnvvlmgrk
twesiplqfrplkgrinvvitrnesldlgngihsaksldhalellyrtygsessvqinri
fviggaqlykaamdhpkldrimatiiykdihcdvffplkfrdkewssvwkkekhsdlesw
vgtkvphgkinedgfdyefemwtrdl

Timeline for d1daja_:

• d1daja_ first appeared (with stable ids) in SCOP 1.55, called d1daj__
  
• d1daja_ appears in SCOPe 2.07