PDB entry 1daj

View 1daj on RCSB PDB site
Description: comparison of ternary complexes of pneumocystis carinii and wild type human dihydrofolate reductase with coenzyme nadph and a novel classical antitumor furo[2,3d]pyrimidine antifolate
Class: oxidoreductase
Keywords: oxidoreductase
Deposited on 1997-07-29, released 1997-12-24
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: 0.181
AEROSPACI score: 0.32 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: dihydrofolate reductase
    Species: Pneumocystis carinii [TaxId:4754]
    Gene: C-DNA PNEUMOCYSTIS CARINII DHF
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1daja_
  • Heterogens: NDP, MOT, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1dajA (A:)
    mnqqksltlivalttsygigrsnslpwklkkeisyfkrvtsfvptfdsfesmnvvlmgrk
    twesiplqfrplkgrinvvitrnesldlgngihsaksldhalellyrtygsessvqinri
    fviggaqlykaamdhpkldrimatiiykdihcdvffplkfrdkewssvwkkekhsdlesw
    vgtkvphgkinedgfdyefemwtrdl