SCOPe 2.08: Domain d6aq7a1: 6aq7 A:127-224

Lineage for d6aq7a1 (6aq7 A:127-224)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.6: Prion-like [54097] (1 superfamily)
   beta-alpha-beta-alpha(2); antiparallel beta-ribbon

4. Superfamily d.6.1: Prion-like [54098] (1 family)

5. Family d.6.1.1: Prion-like [54099] (3 proteins)

6. Protein automated matches [191016] (9 species)
   not a true protein

7. Species Mouse (Mus musculus) [TaxId:10090] [234629] (15 PDB entries)

8. Domain d6aq7a1: 6aq7 A:127-224 [349208]
   Other proteins in same PDB: d6aq7a2, d6aq7h_, d6aq7l1, d6aq7l2
   automated match to d1xyxa_
   complexed with gol, tce

Details for d6aq7a1

PDB Entry: 6aq7, 1.83 Å

PDB Description: structure of pom6 fab fragment complexed with mouse prpc

PDB Compounds: (A:) major prion protein

SCOPe Domain Sequences for d6aq7a1:

Sequence; same for both SEQRES and ATOM records:

>d6aq7a1 d.6.1.1 (A:127-224) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
ymlgsamsrpmihfgndwedryyrenmyrypnqvyyrpvdqysnqnnfvhdcvnitikqh
tvttttkgenftetdvkmmervveqmcvtqyqkesqay

Timeline for d6aq7a1:

• d6aq7a1 first appeared in SCOPe 2.07