PDB entry 6aq7

View 6aq7 on RCSB PDB site
Description: Structure of POM6 FAB fragment complexed with mouse PrPc
Class: immune system
Keywords: Prion, antibody, chaperone, antigen-antibody, IMMUNE SYSTEM
Deposited on 2017-08-18, released 2018-04-04
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-04-04, with a file datestamp of 2018-03-29.
Experiment type: XRAY
Resolution: 1.83 Å
R-factor: N/A
AEROSPACI score: 0.35 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: major prion protein
    Species: Mus musculus [TaxId:10090]
    Gene: Prnp, Prn-p, Prp
    Database cross-references and differences (RAF-indexed):
    • Uniprot P04925 (23-End)
      • expression tag (21-22)
    Domains in SCOPe 2.07: d6aq7a1, d6aq7a2
  • Chain 'H':
    Compound: POM6 FAB Heavy CHAIN
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 6AQ7 (0-213)
  • Chain 'L':
    Compound: POM6 FAB light CHAIN
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 6AQ7 (0-215)
    Domains in SCOPe 2.07: d6aq7l1, d6aq7l2
  • Heterogens: GOL, TCE, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >6aq7A (A:)
    mgsshhhhhhssglvprgshmggymlgsamsrpmihfgndwedryyrenmyrypnqvyyr
    pvdqysnqnnfvhdcvnitikqhtvttttkgenftetdvkmmervveqmcvtqyqkesqa
    yy
    

    Sequence, based on observed residues (ATOM records): (download)
    >6aq7A (A:)
    ggymlgsamsrpmihfgndwedryyrenmyrypnqvyyrpvdqysnqnnfvhdcvnitik
    qhtvttttkgenftetdvkmmervveqmcvtqyqkesqay
    

  • Chain 'H':
    No sequence available.

  • Chain 'L':
    Sequence; same for both SEQRES and ATOM records: (download)
    >6aq7L (L:)
    divmtqspavlatsngeratitckasmsvststysymdwyqqkpgqppkllikkasnnet
    gvparfsgsgtkkdftltihpvqqedvstyycqhswqtpltfgagtvlelkradaaptvs
    ifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnsetdqdskdstysms
    stltltkdeyerhnsytceathktstspivksfnra