Lineage for d1dr5__ (1dr5 -)

  1. Root: SCOP 1.55
  2. 18352Class c: Alpha and beta proteins (a/b) [51349] (97 folds)
  3. 26980Fold c.71: Dihydrofolate reductases [53596] (1 superfamily)
  4. 26981Superfamily c.71.1: Dihydrofolate reductases [53597] (1 family) (S)
  5. 26982Family c.71.1.1: Dihydrofolate reductases [53598] (3 proteins)
  6. 27067Protein Dihydrofolate reductases, eukaryotic type [53605] (4 species)
  7. 27068Species Chicken (Gallus gallus) [TaxId:9031] [53606] (8 PDB entries)
  8. 27075Domain d1dr5__: 1dr5 - [34901]

Details for d1dr5__

PDB Entry: 1dr5 (more details), 2.4 Å

PDB Description: crystal structures of organomercurial-activated chicken liver dihydrofolate reductase complexes

SCOP Domain Sequences for d1dr5__:

Sequence; same for both SEQRES and ATOM records: (download)

>d1dr5__ c.71.1.1 (-) Dihydrofolate reductases, eukaryotic type {Chicken (Gallus gallus)}
vrslnsivavcqnmgigkdgnlpwpplrneykyfqrmtstshvegkqnavimgkktwfsi
peknrplkdrinivlsrelkeapkgahylskslddalalldspelkskvdmvwivggtav
ykaamekpinhrlfvtrilhefesdtffpeidykdfkllteypgvpadiqeedgiqykfe
vyqksv

SCOP Domain Coordinates for d1dr5__:

Click to download the PDB-style file with coordinates for d1dr5__.
(The format of our PDB-style files is described here.)

Timeline for d1dr5__: