Lineage for d5yvtb_ (5yvt B:)

  1. Root: SCOPe 2.08
  2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. Fold c.77: Isocitrate/Isopropylmalate dehydrogenase-like [53658] (1 superfamily)
    consists of two intertwined (sub)domains related by pseudo dyad; duplication
    3 layers: a/b/a; single mixed beta-sheet of 10 strands, order 213A945867 (A=10); strands from 5 to 9 are antiparallel to the rest
  4. Superfamily c.77.1: Isocitrate/Isopropylmalate dehydrogenase-like [53659] (6 families) (S)
    the constituent families form similar dimers
  5. Family c.77.1.0: automated matches [191423] (1 protein)
    not a true family
  6. Protein automated matches [190603] (25 species)
    not a true protein
  7. Species Human (Homo sapiens) [TaxId:9606] [329721] (11 PDB entries)
  8. Domain d5yvtb_: 5yvt B: [348966]
    automated match to d3blxc_
    complexed with mg, nai

Details for d5yvtb_

PDB Entry: 5yvt (more details), 2.4 Å

PDB Description: crystal structure of the alpha gamma heterodimer of human idh3 in complex with mg(2+) and nadh
PDB Compounds: (B:) Isocitrate dehydrogenase [NAD] subunit gamma, mitochondrial

SCOPe Domain Sequences for d5yvtb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5yvtb_ c.77.1.0 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
rhtvtmipgdgigpelmlhvksvfrhacvpvdfeevhvssnadeedirnaimairrnrva
lkgnietnhnlppshksrnnilrtsldlyanvihckslpgvvtrhkdidilivrentege
ysslehesvagvveslkiitkakslriaeyafklaqesgrkkvtavhkanimklgdglfl
qccrevaarypqitfenmivdnttmqlvsrpqqfdvmvmpnlygnivnnvcaglvggpgl
vaganyghvyavfetatrntgksianknianptatllascmmldhlklhsyatsirkavl
asmdnenmhtpdiggqgttseaiqdvirhirvi

SCOPe Domain Coordinates for d5yvtb_ are not available.

Timeline for d5yvtb_:

View in 3D
Domains from other chains:
(mouse over for more information)
d5yvta_