PDB entry 5yvt

View 5yvt on RCSB PDB site
Description: Crystal structure of the alpha gamma heterodimer of human IDH3 in complex with Mg(2+) and NADH
Class: oxidoreductase
Keywords: NADH, Inhibition, OXIDOREDUCTASE
Deposited on 2017-11-27, released 2018-03-14
The last revision prior to the SCOPe 2.08 freeze date was dated 2018-03-28, with a file datestamp of 2018-03-23.
Experiment type: XRAY
Resolution: 2.4 Å
R-factor: N/A
AEROSPACI score: 0.22 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Isocitrate dehydrogenase [NAD] subunit alpha, mitochondrial
    Species: Homo sapiens [TaxId:9606]
    Gene: IDH3A
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d5yvta_
  • Chain 'B':
    Compound: Isocitrate dehydrogenase [NAD] subunit gamma, mitochondrial
    Species: Homo sapiens [TaxId:9606]
    Gene: IDH3G
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d5yvtb_
  • Heterogens: MG, NAI, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5yvtA (A:)
    tggvqtvtlipgdgigpeisaavmkifdaakapiqweernvtaiqgpggkwmipseakes
    mdknkmglkgplktpiaaghpsmnlllrktfdlyanvrpcvsiegyktpytdvnivtire
    ntegeysgiehvivdgvvqsiklitegaskriaefafeyarnnhrsnvtavhkanimrms
    dglflqkcrevaesckdikfnemyldtvclnmvqdpsqfdvlvmpnlygdilsdlcagli
    gglgvtpsgnigangvaifesvhgtapdiagkdmanptalllsavmmlrhmglfdhaari
    eaacfatikdgksltkdlggnakcsdfteeicrrvkdld
    

    Sequence, based on observed residues (ATOM records): (download)
    >5yvtA (A:)
    vqtvtlipgdgigpeisaavmkifdaakapiqweernvtaiqgpggkwmipseakesmdk
    nkmglkgplktpiaapsmnlllrktfdlyanvrpcvsiegyktpytdvnivtirentege
    ysgiehvivdgvvqsiklitegaskriaefafeyarnnhrsnvtavhkanimrmsdglfl
    qkcrevaesckdikfnemyldtvclnmvqdpsqfdvlvmpnlygdilsdlcagligglgv
    tpsgnigangvaifesvhgtapdiagkdmanptalllsavmmlrhmglfdhaarieaacf
    atikdgksltkdlggnakcsdfteeicrrvkd
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5yvtB (B:)
    fseqtippsakyggrhtvtmipgdgigpelmlhvksvfrhacvpvdfeevhvssnadeed
    irnaimairrnrvalkgnietnhnlppshksrnnilrtsldlyanvihckslpgvvtrhk
    didilivrentegeysslehesvagvveslkiitkakslriaeyafklaqesgrkkvtav
    hkanimklgdglflqccrevaarypqitfenmivdnttmqlvsrpqqfdvmvmpnlygni
    vnnvcaglvggpglvaganyghvyavfetatrntgksianknianptatllascmmldhl
    klhsyatsirkavlasmdnenmhtpdiggqgttseaiqdvirhirvingravea
    

    Sequence, based on observed residues (ATOM records): (download)
    >5yvtB (B:)
    rhtvtmipgdgigpelmlhvksvfrhacvpvdfeevhvssnadeedirnaimairrnrva
    lkgnietnhnlppshksrnnilrtsldlyanvihckslpgvvtrhkdidilivrentege
    ysslehesvagvveslkiitkakslriaeyafklaqesgrkkvtavhkanimklgdglfl
    qccrevaarypqitfenmivdnttmqlvsrpqqfdvmvmpnlygnivnnvcaglvggpgl
    vaganyghvyavfetatrntgksianknianptatllascmmldhlklhsyatsirkavl
    asmdnenmhtpdiggqgttseaiqdvirhirvi