Lineage for d1re7b_ (1re7 B:)

  1. Root: SCOP 1.55
  2. 18352Class c: Alpha and beta proteins (a/b) [51349] (97 folds)
  3. 26980Fold c.71: Dihydrofolate reductases [53596] (1 superfamily)
  4. 26981Superfamily c.71.1: Dihydrofolate reductases [53597] (1 family) (S)
  5. 26982Family c.71.1.1: Dihydrofolate reductases [53598] (3 proteins)
  6. 26986Protein Dihydrofolate reductase, prokaryotic type [53599] (5 species)
  7. 26987Species Escherichia coli [TaxId:562] [53600] (42 PDB entries)
  8. 27044Domain d1re7b_: 1re7 B: [34876]

Details for d1re7b_

PDB Entry: 1re7 (more details), 2.6 Å

PDB Description: dihydrofolate reductase complexed with folate

SCOP Domain Sequences for d1re7b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1re7b_ c.71.1.1 (B:) Dihydrofolate reductase, prokaryotic type {Escherichia coli}
misliaalavdrvigmenampwnlpadlawfkrntldkpvimgrhtwesigrplpgrkni
ilssqpgtddrvtwvksvdeaiaacgdvpeimvigggrvyeqflpkaqklylthidaeve
gdthfpdyepddwesvfsefhdadaqnshsycfeilerr

SCOP Domain Coordinates for d1re7b_:

Click to download the PDB-style file with coordinates for d1re7b_.
(The format of our PDB-style files is described here.)

Timeline for d1re7b_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1re7a_