Lineage for d5wg4a2 (5wg4 A:186-548)

  1. Root: SCOPe 2.07
  2. 2494617Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2542179Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily)
    consists of two alpha+beta domains, C-terminal domain is mostly alpha helical
  4. 2542180Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (8 families) (S)
    shares functional and structural similarities with the ATP-grasp fold and PIPK
  5. 2542316Family d.144.1.7: Protein kinases, catalytic subunit [88854] (66 proteins)
    members organized in the groups and subfamiles specified by the comments
  6. 2545120Protein automated matches [190091] (17 species)
    not a true protein
  7. 2545220Species Human (Homo sapiens) [TaxId:9606] [188447] (676 PDB entries)
  8. 3048470Domain d5wg4a2: 5wg4 A:186-548 [348532]
    Other proteins in same PDB: d5wg4a1, d5wg4a3, d5wg4b_, d5wg4g_
    automated match to d3v5wa2
    complexed with afv

Details for d5wg4a2

PDB Entry: 5wg4 (more details), 2.31 Å

PDB Description: human grk2 in complex with gbetagamma subunits and ccg257284
PDB Compounds: (A:) Beta-adrenergic receptor kinase 1

SCOPe Domain Sequences for d5wg4a2:

Sequence, based on SEQRES records: (download)

>d5wg4a2 d.144.1.7 (A:186-548) automated matches {Human (Homo sapiens) [TaxId: 9606]}
ltmndfsvhriigrggfgevygcrkadtgkmyamkcldkkrikmkqgetlalnerimlsl
vstgdcpfivcmsyafhtpdklsfildlmnggdlhyhlsqhgvfseadmrfyaaeiilgl
ehmhnrfvvyrdlkpanilldehghvrisdlglacdfskkkphasvgthgymapevlqkg
vaydssadwfslgcmlfkllrghspfrqhktkdkheidrmtltmavelpdsfspelrsll
egllqrdvnrrlgclgrgaqevkespffrsldwqmvflqkyppplipprgevnaadafdi
gsfdeedtkgiklldsdqelyrnfpltiserwqqevaetvfdtinaetdrlearkkaknk
qlg

Sequence, based on observed residues (ATOM records): (download)

>d5wg4a2 d.144.1.7 (A:186-548) automated matches {Human (Homo sapiens) [TaxId: 9606]}
ltmndfsvhriigrggfgevygcrkadtgkmyamkcldkkrikmkqgetlalnerimlsl
vstgdcpfivcmsyafhtpdklsfildlmnggdlhyhlsqhgvfseadmrfyaaeiilgl
ehmhnrfvvyrdlkpanilldehghvrisdlglacdfskkkphasvgthgymapevlqkg
vaydssadwfslgcmlfkllrghspfrqhktkdkheidrmtltvelpdsfspelrslleg
llqrdvnrrlgclgrgaqevkespffrsldwqmvflqkyppplipprgevnaadatkgik
lldsdqelyrnfpltiserwqqevaetvfdtinaetdrlearkkaknkqlg

SCOPe Domain Coordinates for d5wg4a2:

Click to download the PDB-style file with coordinates for d5wg4a2.
(The format of our PDB-style files is described here.)

Timeline for d5wg4a2:

  • d5wg4a2 appears in periodic updates to SCOPe 2.07 starting on 2018-04-07