Lineage for d5wg4a1 (5wg4 A:31-185)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2328088Fold a.91: Regulator of G-protein signaling, RGS [48096] (1 superfamily)
    multihelical; consists of two all-alpha subdomains
    contains a 4-helical bundle with left-handed twist and up-and-down topology
  4. 2328089Superfamily a.91.1: Regulator of G-protein signaling, RGS [48097] (2 families) (S)
  5. 2328150Family a.91.1.0: automated matches [191379] (1 protein)
    not a true family
  6. 2328151Protein automated matches [190464] (3 species)
    not a true protein
  7. 2328160Species Human (Homo sapiens) [TaxId:9606] [187381] (35 PDB entries)
  8. 3048469Domain d5wg4a1: 5wg4 A:31-185 [348531]
    Other proteins in same PDB: d5wg4a2, d5wg4a3, d5wg4b_, d5wg4g_
    automated match to d3v5wa1
    complexed with afv

Details for d5wg4a1

PDB Entry: 5wg4 (more details), 2.31 Å

PDB Description: human grk2 in complex with gbetagamma subunits and ccg257284
PDB Compounds: (A:) Beta-adrenergic receptor kinase 1

SCOPe Domain Sequences for d5wg4a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5wg4a1 a.91.1.0 (A:31-185) automated matches {Human (Homo sapiens) [TaxId: 9606]}
killpepsirsvmqkyledrgevtfekifsqklgyllfrdfclnhleearplvefyeeik
kyekleteeervarsreifdsyimkellacshpfsksatehvqghlgkkqvppdlfqpyi
eeicqnlrgdvfqkfiesdkftrfcqwknvelnih

SCOPe Domain Coordinates for d5wg4a1:

Click to download the PDB-style file with coordinates for d5wg4a1.
(The format of our PDB-style files is described here.)

Timeline for d5wg4a1:

  • d5wg4a1 appears in periodic updates to SCOPe 2.07 starting on 2018-04-07