Lineage for d5wg4a3 (5wg4 A:552-668)

  1. Root: SCOPe 2.07
  2. 2344607Class b: All beta proteins [48724] (178 folds)
  3. 2394380Fold b.55: PH domain-like barrel [50728] (3 superfamilies)
    barrel, partly opened; n*=6, S*=12; meander; capped by an alpha-helix
  4. 2394381Superfamily b.55.1: PH domain-like [50729] (14 families) (S)
  5. 2394983Family b.55.1.0: automated matches [191311] (1 protein)
    not a true family
  6. 2394984Protein automated matches [190052] (7 species)
    not a true protein
  7. 2395025Species Human (Homo sapiens) [TaxId:9606] [186914] (62 PDB entries)
  8. 3048471Domain d5wg4a3: 5wg4 A:552-668 [348533]
    Other proteins in same PDB: d5wg4a1, d5wg4a2, d5wg4b_, d5wg4g_
    automated match to d3krwa3
    complexed with afv

Details for d5wg4a3

PDB Entry: 5wg4 (more details), 2.31 Å

PDB Description: human grk2 in complex with gbetagamma subunits and ccg257284
PDB Compounds: (A:) Beta-adrenergic receptor kinase 1

SCOPe Domain Sequences for d5wg4a3:

Sequence, based on SEQRES records: (download)

>d5wg4a3 b.55.1.0 (A:552-668) automated matches {Human (Homo sapiens) [TaxId: 9606]}
dyalgkdcimhgymskmgnpfltqwqrryfylfpnrlewrgegeapqslltmeeiqsvee
tqikerkclllkirggkqfilqcdsdpelvqwkkelrdayreaqqlvqrvpkmknkp

Sequence, based on observed residues (ATOM records): (download)

>d5wg4a3 b.55.1.0 (A:552-668) automated matches {Human (Homo sapiens) [TaxId: 9606]}
dyalgkdcimhgymskmgnpfltqwqrryfylfpnrlewrgeapqslltmeeiqsveetq
ikerkclllkirggkqfilqcdsdpelvqwkkelrdayreaqqlvqrvpkmknkp

SCOPe Domain Coordinates for d5wg4a3:

Click to download the PDB-style file with coordinates for d5wg4a3.
(The format of our PDB-style files is described here.)

Timeline for d5wg4a3:

  • d5wg4a3 appears in periodic updates to SCOPe 2.07 starting on 2018-04-07