SCOPe 2.07: Domain d5w08l1: 5w08 L:2-109

Lineage for d5w08l1 (5w08 L:2-109)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.0: automated matches [191470] (1 protein)
   not a true family

6. Protein automated matches [190740] (29 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187920] (1626 PDB entries)

8. Domain d5w08l1: 5w08 L:2-109 [348262]
   Other proteins in same PDB: d5w08a_, d5w08b_, d5w08c_, d5w08d_, d5w08e_, d5w08f_, d5w08h2, d5w08j2, d5w08l2, d5w08n2, d5w08p2, d5w08r2
   automated match to d1mcda1
   complexed with bma, gol, nag

Details for d5w08l1

PDB Entry: 5w08, 2.6 Å

PDB Description: a/texas/50/2012(h3n2) influenza hemagglutinin in complex with k03.12 fab

PDB Compounds: (L:) K03.12 antibody light chain

SCOPe Domain Sequences for d5w08l1:

Sequence; same for both SEQRES and ATOM records:

>d5w08l1 b.1.1.0 (L:2-109) automated matches {Human (Homo sapiens) [TaxId: 9606]}
saltqpasvsgspgqsvtisctgtnsdvgtfdlvswyqqypgkapkliiyegsrrpsgvs
drfsgsksgntasltisglqaedeadyycssyagsvvfgggtkltvlg

Timeline for d5w08l1:

• d5w08l1 is new in SCOPe 2.07-stable
  
• d5w08l1 appears in the current release, SCOPe 2.08