Lineage for d5w08f_ (5w08 F:)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2385148Fold b.19: Viral protein domain [49817] (1 superfamily)
    sandwich; 9 strands in 2 sheets; jelly-roll; form trimers
  4. 2385149Superfamily b.19.1: Viral protein domain [49818] (4 families) (S)
    forms homotrimers
  5. 2385196Family b.19.1.2: Influenza hemagglutinin headpiece [49823] (2 proteins)
  6. 2385678Protein automated matches [190291] (21 species)
    not a true protein
  7. 2385727Species Influenza a virus (a/texas/50/2012(h3n2)) [TaxId:1321009] [347902] (3 PDB entries)
  8. 2385736Domain d5w08f_: 5w08 F: [348199]
    Other proteins in same PDB: d5w08h1, d5w08h2, d5w08j1, d5w08j2, d5w08l1, d5w08l2, d5w08n1, d5w08n2, d5w08p1, d5w08p2, d5w08r1, d5w08r2
    automated match to d5umna_
    complexed with bma, gol, nag

Details for d5w08f_

PDB Entry: 5w08 (more details), 2.6 Å

PDB Description: a/texas/50/2012(h3n2) influenza hemagglutinin in complex with k03.12 fab
PDB Compounds: (F:) hemagglutinin HA1

SCOPe Domain Sequences for d5w08f_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5w08f_ b.19.1.2 (F:) automated matches {Influenza a virus (a/texas/50/2012(h3n2)) [TaxId: 1321009]}
atelvqnssigeicdsphqildgenctlidallgdpqcdgfqnkkwdlfverskaysncy
pydvpdyaslrslvassgtlefnnesfnwngvtqngtssacirrsnnsffsrlnwlthln
fkypalnvtmpnneqfdklyiwgvhhpvtdkdqiflyaqpsgritvstkrsqqavipnig
frprirnipsrisiywtivkpgdillinstgnliaprgyfkirsgkssimrsdapigkck
secitpngsipndkpfqnvnritygacpryvkqs

SCOPe Domain Coordinates for d5w08f_:

Click to download the PDB-style file with coordinates for d5w08f_.
(The format of our PDB-style files is described here.)

Timeline for d5w08f_: