Lineage for d5w08j1 (5w08 J:1-109)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2352459Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2352460Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2365354Family b.1.1.0: automated matches [191470] (1 protein)
    not a true family
  6. 2365355Protein automated matches [190740] (29 species)
    not a true protein
  7. 2365565Species Human (Homo sapiens) [TaxId:9606] [187920] (1626 PDB entries)
  8. 2368530Domain d5w08j1: 5w08 J:1-109 [348030]
    Other proteins in same PDB: d5w08a_, d5w08b_, d5w08c_, d5w08d_, d5w08e_, d5w08f_, d5w08h2, d5w08j2, d5w08l2, d5w08n2, d5w08p2, d5w08r2
    automated match to d1mcda1
    complexed with bma, gol, nag

Details for d5w08j1

PDB Entry: 5w08 (more details), 2.6 Å

PDB Description: a/texas/50/2012(h3n2) influenza hemagglutinin in complex with k03.12 fab
PDB Compounds: (J:) K03.12 antibody light chain

SCOPe Domain Sequences for d5w08j1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5w08j1 b.1.1.0 (J:1-109) automated matches {Human (Homo sapiens) [TaxId: 9606]}
psaltqpasvsgspgqsvtisctgtnsdvgtfdlvswyqqypgkapkliiyegsrrpsgv
sdrfsgsksgntasltisglqaedeadyycssyagsvvfgggtkltvlg

SCOPe Domain Coordinates for d5w08j1:

Click to download the PDB-style file with coordinates for d5w08j1.
(The format of our PDB-style files is described here.)

Timeline for d5w08j1: