Lineage for d5vbqa1 (5vbq A:29-136)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2706693Fold a.29: Bromodomain-like [47363] (15 superfamilies)
    4 helices; bundle; minor mirror variant of up-and-down topology
  4. 2706694Superfamily a.29.2: Bromodomain [47370] (2 families) (S)
  5. 2706927Family a.29.2.0: automated matches [191428] (1 protein)
    not a true family
  6. 2706928Protein automated matches [190615] (15 species)
    not a true protein
  7. 2706959Species Human (Homo sapiens) [TaxId:9606] [187641] (1052 PDB entries)
  8. 2707529Domain d5vbqa1: 5vbq A:29-136 [348056]
    Other proteins in same PDB: d5vbqa2, d5vbqb2
    automated match to d2nxba_
    complexed with cl, edo, r78

Details for d5vbqa1

PDB Entry: 5vbq (more details), 1.65 Å

PDB Description: crystal structure of the first bromodomain of human brdt in complex with bi2536
PDB Compounds: (A:) Bromodomain testis-specific protein

SCOPe Domain Sequences for d5vbqa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5vbqa1 a.29.2.0 (A:29-136) automated matches {Human (Homo sapiens) [TaxId: 9606]}
tnqlqylqkvvlkdlwkhsfswpfqrpvdavklqlpdyytiiknpmdlntikkrlenkyy
akaseciedfntmfsncylynkpgddivlmaqaleklfmqklsqmpqe

SCOPe Domain Coordinates for d5vbqa1:

Click to download the PDB-style file with coordinates for d5vbqa1.
(The format of our PDB-style files is described here.)

Timeline for d5vbqa1:

View in 3D
Domains from same chain:
(mouse over for more information)
d5vbqa2