PDB entry 5vbq

View 5vbq on RCSB PDB site
Description: crystal structure of the first bromodomain of human brdt in complex with bi2536
Class: transcription/inhibitor
Keywords: bromodomain, cap, hunk1, mcap, protein binding-inhibitor complex, mitotic chromosome associated protein, inhibitor, transcription-inhibitor complex
Deposited on 2017-03-30, released 2018-04-04
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-04-04, with a file datestamp of 2018-03-29.
Experiment type: XRAY
Resolution: 1.65 Å
R-factor: N/A
AEROSPACI score: 0.43 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Bromodomain testis-specific protein
    Species: Homo sapiens [TaxId:9606]
    Gene: BRDT
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q58F21 (4-End)
      • expression tag (0-3)
    Domains in SCOPe 2.07: d5vbqa1, d5vbqa2
  • Chain 'B':
    Compound: Bromodomain testis-specific protein
    Species: Homo sapiens [TaxId:9606]
    Gene: BRDT
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q58F21 (4-End)
      • expression tag (0-3)
    Domains in SCOPe 2.07: d5vbqb1, d5vbqb2
  • Heterogens: R78, CL, EDO, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5vbqA (A:)
    gaastnqlqylqkvvlkdlwkhsfswpfqrpvdavklqlpdyytiiknpmdlntikkrle
    nkyyakaseciedfntmfsncylynkpgddivlmaqaleklfmqklsqmpqee
    

    Sequence, based on observed residues (ATOM records): (download)
    >5vbqA (A:)
    gaastnqlqylqkvvlkdlwkhsfswpfqrpvdavklqlpdyytiiknpmdlntikkrle
    nkyyakaseciedfntmfsncylynkpgddivlmaqaleklfmqklsqmpqe
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5vbqB (B:)
    gaastnqlqylqkvvlkdlwkhsfswpfqrpvdavklqlpdyytiiknpmdlntikkrle
    nkyyakaseciedfntmfsncylynkpgddivlmaqaleklfmqklsqmpqee
    

    Sequence, based on observed residues (ATOM records): (download)
    >5vbqB (B:)
    gaastnqlqylqkvvlkdlwkhsfswpfqrpvdavklqlpdyytiiknpmdlntikkrle
    nkyyakaseciedfntmfsncylynkpgddivlmaqaleklfmqklsqmpqe