Lineage for d1gpl_2 (1gpl 1-336)

  1. Root: SCOP 1.63
  2. 235644Class c: Alpha and beta proteins (a/b) [51349] (117 folds)
  3. 248565Fold c.69: alpha/beta-Hydrolases [53473] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 8 strands, order 12435678, strand 2 is antiparallel to the rest
  4. 248566Superfamily c.69.1: alpha/beta-Hydrolases [53474] (26 families) (S)
    many members have left-handed crossover connection between strand 8 and additional strand 9
  5. 248961Family c.69.1.19: Pancreatic lipase, N-terminal domain [53577] (1 protein)
  6. 248962Protein Pancreatic lipase, N-terminal domain [53578] (6 species)
    contains additional, colipase-binding domain
  7. 248965Species Guinea pig (Cavia porcellus) [TaxId:10141] [53582] (1 PDB entry)
  8. 248966Domain d1gpl_2: 1gpl 1-336 [34793]
    Other proteins in same PDB: d1gpl_1
    complexed with ca; mutant

Details for d1gpl_2

PDB Entry: 1gpl (more details), 2.1 Å

PDB Description: rp2 lipase

SCOP Domain Sequences for d1gpl_2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1gpl_2 c.69.1.19 (1-336) Pancreatic lipase, N-terminal domain {Guinea pig (Cavia porcellus)}
aevcyshlgcfsdekpwagtsqrpikslpsdpkkintrfllytnenqnsyqlitatdiat
ikasnfnlnrktrfiihgftdsgenswlsdmcknmfqvekvncicvdwkggskaqysqas
qnirvvgaevaylvqvlstslnyapenvhiighslgahtageagkrlnglvgritgldpa
epyfqdtpeevrldpsdakfvdvihtdispilpslgfgmsqkvghmdffpnggkdmpgck
tgiscnhhrsieyyhssilnpegflgypcasydefqesgcfpcpakgcpkmghfadqypg
ktnaveqtfflntgasdnft

SCOP Domain Coordinates for d1gpl_2:

Click to download the PDB-style file with coordinates for d1gpl_2.
(The format of our PDB-style files is described here.)

Timeline for d1gpl_2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1gpl_1