SCOPe 2.07: Domain d5lipa_: 5lip A:

Lineage for d5lipa_ (5lip A:)

1. Root: SCOPe 2.07

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.69: alpha/beta-Hydrolases [53473] (1 superfamily)
   core: 3 layers, a/b/a; mixed beta-sheet of 8 strands, order 12435678, strand 2 is antiparallel to the rest

4. Superfamily c.69.1: alpha/beta-Hydrolases [53474] (42 families)
   many members have left-handed crossover connection between strand 8 and additional strand 9

5. Family c.69.1.18: Bacterial lipase [53570] (4 proteins)
   lack the first two strands of the common fold

6. Protein Lipase [53571] (4 species)

7. Species Burkholderia cepacia, formerly Pseudomonas cepacia [TaxId:292] [63399] (6 PDB entries)

8. Domain d5lipa_: 5lip A: [34784]
   complexed with ca, ocp

Details for d5lipa_

PDB Entry: 5lip, 2.9 Å

PDB Description: pseudomonas lipase complexed with rc-(rp, sp)-1,2-dioctylcarbamoylglycero-3-o-octylphosphonate

PDB Compounds: (A:) triacyl-glycerol hydrolase

SCOPe Domain Sequences for d5lipa_:

Sequence; same for both SEQRES and ATOM records:

>d5lipa_ c.69.1.18 (A:) Lipase {Burkholderia cepacia, formerly Pseudomonas cepacia [TaxId: 292]}
adnyaatrypiilvhgltgtdkyagvleywygiqedlqqrgatvyvanlsgfqsddgpng
rgeqllayvktvlaatgatkvnlvghsqggltsryvaavapdlvasvttigtphrgsefa
dfvqgvlaydptglsstviaafvnvfgiltsssnntnqdalaalktlttaqaatynqnyp
saglgapgscqtgaptetvggnthllyswagtaiqptisvfgvtgatdtstiplvdpana
ldpstlalfgtgtvmvnrgsgqndgvvskcsalygqvlstsykwnhldeinqllgvrgan
aedpvavirthanrlklagv

Timeline for d5lipa_:

• d5lipa_ first appeared (with stable ids) in SCOP 1.55, called d5lip__
  
• d5lipa_ appears in SCOPe 2.06
  
• d5lipa_ appears in the current release, SCOPe 2.08