Lineage for d5lip__ (5lip -)
- Root: SCOP 1.55
Class c: Alpha and beta proteins (a/b) [51349] (97 folds) 
Fold c.69: alpha/beta-Hydrolases [53473] (1 superfamily) Superfamily c.69.1: alpha/beta-Hydrolases [53474] (20 families) 
Family c.69.1.18: Bacterial lipase [53570] (1 protein) Protein Lipase [53571] (5 species) 
Species Pseudomona sp., ATCC 21808 [53574] (2 PDB entries) 
Domain d5lip__: 5lip - [34784]
Details for d5lip__
PDB Entry: 5lip (more details), 2.9 Å
PDB Description: pseudomonas lipase complexed with rc-(rp, sp)-1,2-dioctylcarbamoylglycero-3-o-octylphosphonate
SCOP Domain Sequences for d5lip__:
Sequence; same for both SEQRES and ATOM records: (download)
>d5lip__ c.69.1.18 (-) Lipase {Pseudomona sp., ATCC 21808}
adnyaatrypiilvhgltgtdkyagvleywygiqedlqqrgatvyvanlsgfqsddgpng
rgeqllayvktvlaatgatkvnlvghsqggltsryvaavapdlvasvttigtphrgsefa
dfvqgvlaydptglsstviaafvnvfgiltsssnntnqdalaalktlttaqaatynqnyp
saglgapgscqtgaptetvggnthllyswagtaiqptisvfgvtgatdtstiplvdpana
ldpstlalfgtgtvmvnrgsgqndgvvskcsalygqvlstsykwnhldeinqllgvrgan
aedpvavirthanrlklagv
SCOP Domain Coordinates for d5lip__:
Click to download the PDB-style file with coordinates for d5lip__.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d5lip__:
- d5lip__ appears in SCOP 1.57
- d5lip__ appears in the current release, SCOPe 2.08, called d5lipa_
View in 3D