Lineage for d5ojaa_ (5oja A:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2685878Fold a.1: Globin-like [46457] (2 superfamilies)
    core: 6 helices; folded leaf, partly opened
  4. 2685879Superfamily a.1.1: Globin-like [46458] (5 families) (S)
  5. 2685963Family a.1.1.2: Globins [46463] (27 proteins)
    Heme-binding protein
  6. 2687850Protein Myoglobin [46469] (11 species)
  7. 2688020Species Sperm whale (Physeter catodon) [TaxId:9755] [46470] (318 PDB entries)
    Uniprot P02185
  8. 2688125Domain d5ojaa_: 5oja A: [347431]
    automated match to d1mtia_
    complexed with hem, imd

Details for d5ojaa_

PDB Entry: 5oja (more details), 1.35 Å

PDB Description: structure of mbq
PDB Compounds: (A:) Myoglobin

SCOPe Domain Sequences for d5ojaa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5ojaa_ a.1.1.2 (A:) Myoglobin {Sperm whale (Physeter catodon) [TaxId: 9755]}
mvlsegewqlvlhvwakveadvaghgqdilirlfkshpeilekfddlkhlkteaemkase
dlkkhgvtvltalgailkkkghheaelkplaqshatkhkipikyleffseaiihvlhsrh
pgdfgadaqgamnkalelfrkdiaakykelgy

SCOPe Domain Coordinates for d5ojaa_:

Click to download the PDB-style file with coordinates for d5ojaa_.
(The format of our PDB-style files is described here.)

Timeline for d5ojaa_: