PDB entry 5oja

View 5oja on RCSB PDB site
Description: Structure of MbQ
Class: oxidoreductase
Keywords: myoglobin, NMH, N-methylhistidine, heme, OXIDOREDUCTASE
Deposited on 2017-07-21, released 2018-01-24
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-02-07, with a file datestamp of 2018-02-02.
Experiment type: XRAY
Resolution: 1.35 Å
R-factor: N/A
AEROSPACI score: 0.56 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Myoglobin
    Species: Physeter catodon [TaxId:9755]
    Gene: MB
    Database cross-references and differences (RAF-indexed):
    • Uniprot P02185 (0-End)
      • conflict (39)
      • conflict (45-46)
      • conflict (107)
    Domains in SCOPe 2.07: d5ojaa_
  • Heterogens: IMD, HEM, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5ojaA (A:)
    mvlsegewqlvlhvwakveadvaghgqdilirlfkshpeilekfddlkhlkteaemkase
    dlkkhgvtvltalgailkkkghheaelkplaqshatkhkipikyleffseaiihvlhsrh
    pgdfgadaqgamnkalelfrkdiaakykelgyqggsghhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >5ojaA (A:)
    mvlsegewqlvlhvwakveadvaghgqdilirlfkshpeilekfddlkhlkteaemkase
    dlkkhgvtvltalgailkkkghheaelkplaqshatkhkipikyleffseaiihvlhsrh
    pgdfgadaqgamnkalelfrkdiaakykelgy