Lineage for d5oj9a1 (5oj9 A:1-153)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2299347Fold a.1: Globin-like [46457] (2 superfamilies)
    core: 6 helices; folded leaf, partly opened
  4. 2299348Superfamily a.1.1: Globin-like [46458] (5 families) (S)
  5. 2299432Family a.1.1.2: Globins [46463] (27 proteins)
    Heme-binding protein
  6. 2301126Protein Myoglobin [46469] (10 species)
  7. 2301271Species Sperm whale (Physeter catodon) [TaxId:9755] [46470] (301 PDB entries)
    Uniprot P02185
  8. 3047270Domain d5oj9a1: 5oj9 A:1-153 [347332]
    Other proteins in same PDB: d5oj9a2
    automated match to d4pnja_
    complexed with hem

Details for d5oj9a1

PDB Entry: 5oj9 (more details), 1.48 Å

PDB Description: structure of mb nmh
PDB Compounds: (A:) Myoglobin

SCOPe Domain Sequences for d5oj9a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5oj9a1 a.1.1.2 (A:1-153) Myoglobin {Sperm whale (Physeter catodon) [TaxId: 9755]}
vlsegewqlvlhvwakveadvaghgqdilirlfkshpetlekfdrfkhlkteaemkased
lkkhgvtvltalgailkkkghheaelkplaqshatkhkipikylefiseaiihvlhsrhp
gdfgadaqgamnkalelfrkdiaakykelgyqg

SCOPe Domain Coordinates for d5oj9a1:

Click to download the PDB-style file with coordinates for d5oj9a1.
(The format of our PDB-style files is described here.)

Timeline for d5oj9a1:

  • d5oj9a1 appears in periodic updates to SCOPe 2.07 starting on 2018-04-06

View in 3D
Domains from same chain:
(mouse over for more information)
d5oj9a2