SCOPe 2.08: Domain d5oj9a1: 5oj9 A:1-153

Lineage for d5oj9a1 (5oj9 A:1-153)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.1: Globin-like [46457] (2 superfamilies)
   core: 6 helices; folded leaf, partly opened

4. Superfamily a.1.1: Globin-like [46458] (5 families)

5. Family a.1.1.2: Globins [46463] (27 proteins)
   Heme-binding protein

6. Protein Myoglobin [46469] (11 species)

7. Species Sperm whale (Physeter catodon) [TaxId:9755] [46470] (318 PDB entries)
   Uniprot P02185

8. Domain d5oj9a1: 5oj9 A:1-153 [347332]
   Other proteins in same PDB: d5oj9a2
   automated match to d4pnja_
   complexed with hem

Details for d5oj9a1

PDB Entry: 5oj9, 1.48 Å

PDB Description: structure of mb nmh

PDB Compounds: (A:) Myoglobin

SCOPe Domain Sequences for d5oj9a1:

Sequence; same for both SEQRES and ATOM records:

>d5oj9a1 a.1.1.2 (A:1-153) Myoglobin {Sperm whale (Physeter catodon) [TaxId: 9755]}
vlsegewqlvlhvwakveadvaghgqdilirlfkshpetlekfdrfkhlkteaemkased
lkkhgvtvltalgailkkkghheaelkplaqshatkhkipikylefiseaiihvlhsrhp
gdfgadaqgamnkalelfrkdiaakykelgyqg

Timeline for d5oj9a1:

• d5oj9a1 first appeared in SCOPe 2.07