PDB entry 5oj9

View 5oj9 on RCSB PDB site
Description: Structure of Mb NMH
Class: oxidoreductase
Keywords: myoglobin, NMH, N-methylhistidine, heme, OXIDOREDUCTASE
Deposited on 2017-07-21, released 2018-01-24
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-02-07, with a file datestamp of 2018-02-02.
Experiment type: XRAY
Resolution: 1.48 Å
R-factor: N/A
AEROSPACI score: 0.5 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Myoglobin
    Species: Physeter catodon [TaxId:9755]
    Gene: MB
    Database cross-references and differences (RAF-indexed):
    • Uniprot P02185 (Start-153)
      • expression tag (154)
    Domains in SCOPe 2.07: d5oj9a1, d5oj9a2
  • Heterogens: HEM, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5oj9A (A:)
    mvlsegewqlvlhvwakveadvaghgqdilirlfkshpetlekfdrfkhlkteaemkase
    dlkkhgvtvltalgailkkkghheaelkplaqshatkhkipikylefiseaiihvlhsrh
    pgdfgadaqgamnkalelfrkdiaakykelgyqggsghhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >5oj9A (A:)
    vlsegewqlvlhvwakveadvaghgqdilirlfkshpetlekfdrfkhlkteaemkased
    lkkhgvtvltalgailkkkghheaelkplaqshatkhkipikylefiseaiihvlhsrhp
    gdfgadaqgamnkalelfrkdiaakykelgyqgg