Class c: Alpha and beta proteins (a/b) [51349] (147 folds) |
Fold c.69: alpha/beta-Hydrolases [53473] (1 superfamily) core: 3 layers, a/b/a; mixed beta-sheet of 8 strands, order 12435678, strand 2 is antiparallel to the rest |
Superfamily c.69.1: alpha/beta-Hydrolases [53474] (41 families) many members have left-handed crossover connection between strand 8 and additional strand 9 |
Family c.69.1.12: Haloperoxidase [53531] (7 proteins) |
Protein Bromoperoxidase A2 [53532] (1 species) |
Species Streptomyces aureofaciens [TaxId:1894] [53533] (2 PDB entries) |
Domain d1brob_: 1bro B: [34701] |
PDB Entry: 1bro (more details), 2.05 Å
SCOP Domain Sequences for d1brob_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1brob_ c.69.1.12 (B:) Bromoperoxidase A2 {Streptomyces aureofaciens [TaxId: 1894]} pfitvgqenstsidlyyedhgtgqpvvlihgfplsghswerqsaalldagyrvitydrrg fgqssqpttgydydtfaadlntvletldlqdavlvgfsmgtgevaryvssygtariakva flaslepfllktddnpdgaapqeffdgivaavkadryafytgffndfynldenlgtrise eavrnswntaasggffaaaaapttwytdfradipridvpalilhgtgdrtlpientarvf hkalpsaeyvevegaphgllwthaeevntallaflak
Timeline for d1brob_: