SCOP 1.73: Domain d1brob_: 1bro B:

Lineage for d1brob_ (1bro B:)

1. Root: SCOP 1.73

2. Class c: Alpha and beta proteins (a/b) [51349] (141 folds)

3. Fold c.69: alpha/beta-Hydrolases [53473] (1 superfamily)
   core: 3 layers, a/b/a; mixed beta-sheet of 8 strands, order 12435678, strand 2 is antiparallel to the rest

4. Superfamily c.69.1: alpha/beta-Hydrolases [53474] (35 families)
   many members have left-handed crossover connection between strand 8 and additional strand 9

5. Family c.69.1.12: Haloperoxidase [53531] (7 proteins)

6. Protein Bromoperoxidase A2 [53532] (1 species)

7. Species Streptomyces aureofaciens [TaxId:1894] [53533] (2 PDB entries)

8. Domain d1brob_: 1bro B: [34701]

Details for d1brob_

PDB Entry: 1bro, 2.05 Å

PDB Description: bromoperoxidase a2

PDB Compounds: (B:) bromoperoxidase a2

SCOP Domain Sequences for d1brob_:

Sequence; same for both SEQRES and ATOM records:

>d1brob_ c.69.1.12 (B:) Bromoperoxidase A2 {Streptomyces aureofaciens [TaxId: 1894]}
pfitvgqenstsidlyyedhgtgqpvvlihgfplsghswerqsaalldagyrvitydrrg
fgqssqpttgydydtfaadlntvletldlqdavlvgfsmgtgevaryvssygtariakva
flaslepfllktddnpdgaapqeffdgivaavkadryafytgffndfynldenlgtrise
eavrnswntaasggffaaaaapttwytdfradipridvpalilhgtgdrtlpientarvf
hkalpsaeyvevegaphgllwthaeevntallaflak

Timeline for d1brob_:

• d1brob_ first appeared (with stable ids) in SCOP 1.55
  
• d1brob_ appears in SCOP 1.71
  
• d1brob_ appears in SCOP 1.75
  
• d1brob_ appears in the current release, SCOPe 2.08