Lineage for d1brob_ (1bro B:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2899459Fold c.69: alpha/beta-Hydrolases [53473] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 8 strands, order 12435678, strand 2 is antiparallel to the rest
  4. 2899460Superfamily c.69.1: alpha/beta-Hydrolases [53474] (43 families) (S)
    many members have left-handed crossover connection between strand 8 and additional strand 9
  5. 2900586Family c.69.1.12: Haloperoxidase [53531] (8 proteins)
    automatically mapped to Pfam PF12697
    automatically mapped to Pfam PF00561
  6. 2900598Protein Bromoperoxidase A2 [53532] (1 species)
  7. 2900599Species Streptomyces aureofaciens [TaxId:1894] [53533] (2 PDB entries)
  8. 2900602Domain d1brob_: 1bro B: [34701]

Details for d1brob_

PDB Entry: 1bro (more details), 2.05 Å

PDB Description: bromoperoxidase a2
PDB Compounds: (B:) bromoperoxidase a2

SCOPe Domain Sequences for d1brob_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1brob_ c.69.1.12 (B:) Bromoperoxidase A2 {Streptomyces aureofaciens [TaxId: 1894]}
pfitvgqenstsidlyyedhgtgqpvvlihgfplsghswerqsaalldagyrvitydrrg
fgqssqpttgydydtfaadlntvletldlqdavlvgfsmgtgevaryvssygtariakva
flaslepfllktddnpdgaapqeffdgivaavkadryafytgffndfynldenlgtrise
eavrnswntaasggffaaaaapttwytdfradipridvpalilhgtgdrtlpientarvf
hkalpsaeyvevegaphgllwthaeevntallaflak

SCOPe Domain Coordinates for d1brob_:

Click to download the PDB-style file with coordinates for d1brob_.
(The format of our PDB-style files is described here.)

Timeline for d1brob_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1broa_