Lineage for d4mpga1 (4mpg A:2-79)

  1. Root: SCOPe 2.07
  2. 2413226Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2455315Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
    core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest
  4. 2455316Superfamily c.47.1: Thioredoxin-like [52833] (24 families) (S)
  5. 2457558Family c.47.1.0: automated matches [191312] (1 protein)
    not a true family
  6. 2457559Protein automated matches [190056] (178 species)
    not a true protein
  7. 2458070Species Human (Homo sapiens) [TaxId:9606] [188013] (109 PDB entries)
  8. 3046543Domain d4mpga1: 4mpg A:2-79 [346605]
    Other proteins in same PDB: d4mpga2
    automated match to d2ljra2
    complexed with fmt, gsh, unl

Details for d4mpga1

PDB Entry: 4mpg (more details), 1.95 Å

PDB Description: crystal structure of human glutathione transferase theta-2, complex with glutathione and unknown ligand, target efi-507257
PDB Compounds: (A:) Glutathione S-transferase theta-2

SCOPe Domain Sequences for d4mpga1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4mpga1 c.47.1.0 (A:2-79) automated matches {Human (Homo sapiens) [TaxId: 9606]}
glelfldlvsqpsravyifakkngiplelrtvdlvkgqhkskeflqinslgklptlkdgd
filtessailiylsckyq

SCOPe Domain Coordinates for d4mpga1:

Click to download the PDB-style file with coordinates for d4mpga1.
(The format of our PDB-style files is described here.)

Timeline for d4mpga1:

  • d4mpga1 appears in periodic updates to SCOPe 2.07 starting on 2018-04-05