PDB entry 4mpg

View 4mpg on RCSB PDB site
Description: Crystal structure of human glutathione transferase theta-2, complex with glutathione and unknown ligand, target EFI-507257
Class: transferase
Keywords: Glutathione S-transferase, Enzyme Function Initiative, EFI, structural genomics, transferase
Deposited on 2013-09-12, released 2013-09-25
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-01-24, with a file datestamp of 2018-01-19.
Experiment type: XRAY
Resolution: 1.95 Å
R-factor: N/A
AEROSPACI score: 0.33 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Glutathione S-transferase theta-2
    Species: Homo sapiens [TaxId:9606]
    Gene: GSTT2
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4mpga1, d4mpga2
  • Chain 'B':
    Compound: Glutathione S-transferase theta-2
    Species: Homo sapiens [TaxId:9606]
    Gene: GSTT2
    Database cross-references and differences (RAF-indexed):
    • Uniprot P0CG29 (22-265)
      • expression tag (11-15)
      • expression tag (19-21)
  • Heterogens: GSH, UNL, FMT, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4mpgA (A:)
    mhhhhhhssgvdlgtenlyfqsmglelfldlvsqpsravyifakkngiplelrtvdlvkg
    qhkskeflqinslgklptlkdgdfiltessailiylsckyqtpdhwypsdlqararvhey
    lgwhadcirgtfgiplwvqvlgpligvqvpkekvernrtamdqalqwledkflgdrpfla
    gqqvtladlmaleelmqpvalgyelfegrprlaawrgrveaflgaelcqeahsiilsile
    qaakktlptpspeayqamllriarip
    

    Sequence, based on observed residues (ATOM records): (download)
    >4mpgA (A:)
    glelfldlvsqpsravyifakkngiplelrtvdlvkgqhkskeflqinslgklptlkdgd
    filtessailiylsckyqtpdhwypsdlqararvheylgwhadcirgtfgiplwvqvlgp
    ligvqvpkekvernrtamdqalqwledkflgdrpflagqqvtladlmaleelmqpvalgy
    elfegrprlaawrgrveaflgaelcqeahsiilsileqaakktlptpspeayqamllria
    rip
    

  • Chain 'B':
    No sequence available.