SCOPe 2.07: Domain d4wy8a1: 4wy8 A:3-319

Lineage for d4wy8a1 (4wy8 A:3-319)

1. Root: SCOPe 2.07

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.69: alpha/beta-Hydrolases [53473] (1 superfamily)
   core: 3 layers, a/b/a; mixed beta-sheet of 8 strands, order 12435678, strand 2 is antiparallel to the rest

4. Superfamily c.69.1: alpha/beta-Hydrolases [53474] (42 families)
   many members have left-handed crossover connection between strand 8 and additional strand 9

5. Family c.69.1.0: automated matches [191404] (1 protein)
   not a true family

6. Protein automated matches [190543] (124 species)
   not a true protein

7. Species Rhizomucor miehei [TaxId:1031333] [346323] (1 PDB entry)

8. Domain d4wy8a1: 4wy8 A:3-319 [345495]
   Other proteins in same PDB: d4wy8a2, d4wy8b2, d4wy8c2, d4wy8d2
   automated match to d5l2pa_

Details for d4wy8a1

PDB Entry: 4wy8, 2.27 Å

PDB Description: structural analysis of two fungal esterases from rhizomucor miehei explaining their substrate specificity

PDB Compounds: (A:) esterase

SCOPe Domain Sequences for d4wy8a1:

Sequence; same for both SEQRES and ATOM records:

>d4wy8a1 c.69.1.0 (A:3-319) automated matches {Rhizomucor miehei [TaxId: 1031333]}
ptvklkpycqniadaatidstqyppevvrkaeaasiiddpkaleglpdvyleektinrkn
gskieltitrpldtenqvlppivffhgggwvvgsklthrrtvyeltvraraavifvnysl
spevrfptaleecldavvwvakeenaksinvdptklvvagdsaggnlsavvcirakqlgl
niikgqvliypvtddnfetdsykqfaenyyltrklmvwffdhyipdkkdrqsifacplka
siddlrvlpralvitaeadvlreegeayarklieagndvtavrylgiihgifnlatlspt
gseildhivawlqktwk

Timeline for d4wy8a1:

• d4wy8a1 is new in SCOPe 2.07-stable
  
• d4wy8a1 appears in the current release, SCOPe 2.08