SCOPe 2.07: Domain d4ep4b_: 4ep4 B:

Lineage for d4ep4b_ (4ep4 B:)

1. Root: SCOPe 2.07

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
   3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest

4. Superfamily c.55.3: Ribonuclease H-like [53098] (16 families)
   consists of one domain of this fold

5. Family c.55.3.6: RuvC resolvase [53134] (2 proteins)
   automatically mapped to Pfam PF02075

6. Protein RuvC resolvase [53135] (2 species)
   Holliday junction-specific endonuclease

7. Species Thermus thermophilus [TaxId:300852] [346310] (3 PDB entries)

8. Domain d4ep4b_: 4ep4 B: [345236]
   automated match to d4ld0a_
   complexed with gol, mg

Details for d4ep4b_

PDB Entry: 4ep4, 1.28 Å

PDB Description: Thermus thermophilus RuvC structure

PDB Compounds: (B:) Crossover junction endodeoxyribonuclease RuvC

SCOPe Domain Sequences for d4ep4b_:

Sequence; same for both SEQRES and ATOM records:

>d4ep4b_ c.55.3.6 (B:) RuvC resolvase {Thermus thermophilus [TaxId: 300852]}
mvvagidpgithlglgvvavegkgalkarllhgevvktspqepakervgriharvlevlh
rfrpeavaveeqffyrqnelaykvgwalgavlvaafeagvpvyaygpmqvkqalaghgha
akeevalmvrgilglkeaprpshladalaialthafyarmgtakpl

Timeline for d4ep4b_:

• d4ep4b_ is new in SCOPe 2.07-stable
  
• d4ep4b_ appears in the current release, SCOPe 2.08