![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies) 3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest |
![]() | Superfamily c.55.3: Ribonuclease H-like [53098] (18 families) ![]() consists of one domain of this fold |
![]() | Family c.55.3.6: RuvC resolvase [53134] (2 proteins) automatically mapped to Pfam PF02075 |
![]() | Protein RuvC resolvase [53135] (2 species) Holliday junction-specific endonuclease |
![]() | Species Thermus thermophilus [TaxId:300852] [346310] (3 PDB entries) |
![]() | Domain d4ep4b_: 4ep4 B: [345236] automated match to d4ld0a_ complexed with gol, mg |
PDB Entry: 4ep4 (more details), 1.28 Å
SCOPe Domain Sequences for d4ep4b_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4ep4b_ c.55.3.6 (B:) RuvC resolvase {Thermus thermophilus [TaxId: 300852]} mvvagidpgithlglgvvavegkgalkarllhgevvktspqepakervgriharvlevlh rfrpeavaveeqffyrqnelaykvgwalgavlvaafeagvpvyaygpmqvkqalaghgha akeevalmvrgilglkeaprpshladalaialthafyarmgtakpl
Timeline for d4ep4b_: