PDB entry 4ep4

View 4ep4 on RCSB PDB site
Description: Thermus thermophilus RuvC structure
Class: hydrolase
Keywords: resolvase, Hydrolase
Deposited on 2012-04-17, released 2012-11-14
The last revision prior to the SCOPe 2.07 freeze date was dated 2014-12-03, with a file datestamp of 2014-11-28.
Experiment type: XRAY
Resolution: 1.28 Å
R-factor: 0.155
AEROSPACI score: 0.69 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Crossover junction endodeoxyribonuclease RuvC
    Species: Thermus thermophilus [TaxId:300852]
    Gene: ruvC, TTHA1090
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4ep4a_
  • Chain 'B':
    Compound: Crossover junction endodeoxyribonuclease RuvC
    Species: Thermus thermophilus [TaxId:300852]
    Gene: ruvC, TTHA1090
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4ep4b_
  • Heterogens: MG, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4ep4A (A:)
    mvvagidpgithlglgvvavegkgalkarllhgevvktspqepakervgriharvlevlh
    rfrpeavaveeqffyrqnelaykvgwalgavlvaafeagvpvyaygpmqvkqalaghgha
    akeevalmvrgilglkeaprpshladalaialthafyarmgtakpl
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4ep4B (B:)
    mvvagidpgithlglgvvavegkgalkarllhgevvktspqepakervgriharvlevlh
    rfrpeavaveeqffyrqnelaykvgwalgavlvaafeagvpvyaygpmqvkqalaghgha
    akeevalmvrgilglkeaprpshladalaialthafyarmgtakpl