Lineage for d4ufwa3 (4ufw A:211-410)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2968378Fold d.108: Acyl-CoA N-acyltransferases (Nat) [55728] (1 superfamily)
    3 layers: a/b/a; contains mixed beta-sheet
  4. 2968379Superfamily d.108.1: Acyl-CoA N-acyltransferases (Nat) [55729] (12 families) (S)
  5. 2968970Family d.108.1.0: automated matches [191308] (1 protein)
    not a true family
  6. 2968971Protein automated matches [190038] (49 species)
    not a true protein
  7. 2969271Species Plasmodium vivax [TaxId:5855] [234134] (20 PDB entries)
  8. 2969300Domain d4ufwa3: 4ufw A:211-410 [344116]
    Other proteins in same PDB: d4ufwa2, d4ufwb2
    complexed with 7y6, cl, dms, mg, nhw, so4

Details for d4ufwa3

PDB Entry: 4ufw (more details), 1.5 Å

PDB Description: plasmodium vivax n-myristoyltransferase in complex with a pyridyl inhibitor (compound 22)
PDB Compounds: (A:) Glycylpeptide N-tetradecanoyltransferase

SCOPe Domain Sequences for d4ufwa3:

Sequence; same for both SEQRES and ATOM records: (download)

>d4ufwa3 d.108.1.0 (A:211-410) automated matches {Plasmodium vivax [TaxId: 5855]}
yyhrsinvkklieigfsslnsrltmsraiklyrvedtlniknmrlmkkkdvegvhkllgs
yleqfnlyavftkeeiahwflpienviytyvneengkikdmisfyslpsqilgndkystl
naaysfynvtttatfkqlmqdaillakrnnfdvfnalevmqnksvfedlkfgegdgslky
ylynwkcasfapahvgivll

SCOPe Domain Coordinates for d4ufwa3:

Click to download the PDB-style file with coordinates for d4ufwa3.
(The format of our PDB-style files is described here.)

Timeline for d4ufwa3: