Lineage for d4ufwc1 (4ufw C:27-210)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2968378Fold d.108: Acyl-CoA N-acyltransferases (Nat) [55728] (1 superfamily)
    3 layers: a/b/a; contains mixed beta-sheet
  4. 2968379Superfamily d.108.1: Acyl-CoA N-acyltransferases (Nat) [55729] (12 families) (S)
  5. 2968970Family d.108.1.0: automated matches [191308] (1 protein)
    not a true family
  6. 2968971Protein automated matches [190038] (49 species)
    not a true protein
  7. 2969271Species Plasmodium vivax [TaxId:5855] [234134] (20 PDB entries)
  8. 2969303Domain d4ufwc1: 4ufw C:27-210 [316593]
    Other proteins in same PDB: d4ufwa2, d4ufwb2
    automated match to d1iica1
    complexed with 7y6, cl, dms, mg, nhw, so4

Details for d4ufwc1

PDB Entry: 4ufw (more details), 1.5 Å

PDB Description: plasmodium vivax n-myristoyltransferase in complex with a pyridyl inhibitor (compound 22)
PDB Compounds: (C:) Glycylpeptide N-tetradecanoyltransferase

SCOPe Domain Sequences for d4ufwc1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4ufwc1 d.108.1.0 (C:27-210) automated matches {Plasmodium vivax [TaxId: 5855]}
dykfwytqpvpkindefnesvnepfisdnkvedvrkdeyklppgyswyvcdvkdekdrse
iytlltdnyvedddnifrfnysaefllwaltspnylktwhigvkydasnkligfisaipt
dicihkrtikmaevnflcvhktlrskrlapvlikeitrrinleniwqaiytagvylpkpv
sdar

SCOPe Domain Coordinates for d4ufwc1:

Click to download the PDB-style file with coordinates for d4ufwc1.
(The format of our PDB-style files is described here.)

Timeline for d4ufwc1: