SCOPe 2.06: Domain d6blxa1: 6blx A:1-84

Lineage for d6blxa1 (6blx A:1-84)

1. Root: SCOPe 2.06

2. Class d: Alpha and beta proteins (a+b) [53931] (385 folds)

3. Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily)
   dimeric

4. Superfamily d.19.1: MHC antigen-recognition domain [54452] (2 families)

5. Family d.19.1.1: MHC antigen-recognition domain [54453] (13 proteins)

6. Protein Class II MHC alpha chain, N-terminal domain [88806] (15 species)

7. Species Mouse (Mus musculus), I-A(G7) [TaxId:10090] [88817] (4 PDB entries)

8. Domain d6blxa1: 6blx A:1-84 [342993]
   Other proteins in same PDB: d6blxa2
   automated match to d1f3ja2
   complexed with edo, fmt, nag

Details for d6blxa1

PDB Entry: 6blx, 2.32 Å

PDB Description: crystal structure of iag7 in complex with insulin mimotope p8g9e

PDB Compounds: (A:) H-2 class II histocompatibility antigen, A-D alpha chain

SCOPe Domain Sequences for d6blxa1:

Sequence; same for both SEQRES and ATOM records:

>d6blxa1 d.19.1.1 (A:1-84) Class II MHC alpha chain, N-terminal domain {Mouse (Mus musculus), I-A(G7) [TaxId: 10090]}
dieadhvgfygttvyqspgdigqythefdgdelfyvdldkkktvwrlpefgqlilfepqg
glqniaaekhnlgiltkrsnftpa

Timeline for d6blxa1:

• d6blxa1 is new in SCOPe 2.06-stable
  
• d6blxa1 appears in SCOPe 2.07
  
• d6blxa1 appears in the current release, SCOPe 2.08