![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily) dimeric |
![]() | Superfamily d.19.1: MHC antigen-recognition domain [54452] (2 families) ![]() |
![]() | Family d.19.1.1: MHC antigen-recognition domain [54453] (13 proteins) |
![]() | Protein Class II MHC alpha chain, N-terminal domain [88806] (15 species) |
![]() | Species Mouse (Mus musculus), I-A(G7) [TaxId:10090] [88817] (4 PDB entries) |
![]() | Domain d6blxa1: 6blx A:1-84 [342993] Other proteins in same PDB: d6blxa2 automated match to d1f3ja2 complexed with edo, fmt, nag fragment; missing more than one-third of the common structure and/or sequence |
PDB Entry: 6blx (more details), 2.32 Å
SCOPe Domain Sequences for d6blxa1:
Sequence; same for both SEQRES and ATOM records: (download)
>d6blxa1 d.19.1.1 (A:1-84) Class II MHC alpha chain, N-terminal domain {Mouse (Mus musculus), I-A(G7) [TaxId: 10090]} dieadhvgfygttvyqspgdigqythefdgdelfyvdldkkktvwrlpefgqlilfepqg glqniaaekhnlgiltkrsnftpa
Timeline for d6blxa1: