SCOPe 2.06: Domain d6blxa2: 6blx A:85-182

Lineage for d6blxa2 (6blx A:85-182)

1. Root: SCOPe 2.06

2. Class b: All beta proteins [48724] (177 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)

6. Protein Class II MHC alpha chain, C-terminal domain [88618] (6 species)

7. Species Mouse (Mus musculus), I-A group [TaxId:10090] [88624] (27 PDB entries)
   probably orthologous to the human HLA-DQ group

8. Domain d6blxa2: 6blx A:85-182 [342994]
   Other proteins in same PDB: d6blxa1
   automated match to d1f3ja1
   complexed with edo, fmt, nag

Details for d6blxa2

PDB Entry: 6blx, 2.32 Å

PDB Description: crystal structure of iag7 in complex with insulin mimotope p8g9e

PDB Compounds: (A:) H-2 class II histocompatibility antigen, A-D alpha chain

SCOPe Domain Sequences for d6blxa2:

Sequence; same for both SEQRES and ATOM records:

>d6blxa2 b.1.1.2 (A:85-182) Class II MHC alpha chain, C-terminal domain {Mouse (Mus musculus), I-A group [TaxId: 10090]}
tneapqatvfpkspvllgqpntlicfvdnifppvinitwlrnsksvtdgvyetsflvnrd
hsfhklsyltfipsdddiydckvehwgleepvlkhwep

Timeline for d6blxa2:

• d6blxa2 is new in SCOPe 2.06-stable
  
• d6blxa2 appears in SCOPe 2.07
  
• d6blxa2 appears in the current release, SCOPe 2.08