| Class b: All beta proteins [48724] (177 folds) |
| Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) ![]() |
| Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins) |
| Protein Class II MHC alpha chain, C-terminal domain [88618] (6 species) |
| Species Mouse (Mus musculus), I-A group [TaxId:10090] [88624] (27 PDB entries) probably orthologous to the human HLA-DQ group |
| Domain d6blxa2: 6blx A:85-182 [342994] Other proteins in same PDB: d6blxa1 automated match to d1f3ja1 complexed with edo, fmt, nag |
PDB Entry: 6blx (more details), 2.32 Å
SCOPe Domain Sequences for d6blxa2:
Sequence; same for both SEQRES and ATOM records: (download)
>d6blxa2 b.1.1.2 (A:85-182) Class II MHC alpha chain, C-terminal domain {Mouse (Mus musculus), I-A group [TaxId: 10090]}
tneapqatvfpkspvllgqpntlicfvdnifppvinitwlrnsksvtdgvyetsflvnrd
hsfhklsyltfipsdddiydckvehwgleepvlkhwep
Timeline for d6blxa2: