SCOPe 2.06: Domain d5wk4e_: 5wk4 E:

Lineage for d5wk4e_ (5wk4 E:)

1. Root: SCOPe 2.06

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.10: Leucine-rich repeat, LRR (right-handed beta-alpha superhelix) [52046] (3 superfamilies)
   2 curved layers, a/b; parallel beta-sheet; order 1234...N; there are sequence similarities between different superfamilies

4. Superfamily c.10.2: L domain-like [52058] (9 families)
   less regular structure consisting of variable repeats

5. Family c.10.2.0: automated matches [191489] (1 protein)
   not a true family

6. Protein automated matches [190787] (11 species)
   not a true protein

7. Species Sea lamprey (Petromyzon marinus) [TaxId:7757] [231246] (6 PDB entries)

8. Domain d5wk4e_: 5wk4 E: [342932]
   automated match to d2o6ra_
   complexed with mg

Details for d5wk4e_

PDB Entry: 5wk4, 1.5 Å

PDB Description: crystal structure of an anti-idiotype vlr

PDB Compounds: (E:) Variable lymphocyte receptor 39

SCOPe Domain Sequences for d5wk4e_:

Sequence; same for both SEQRES and ATOM records:

>d5wk4e_ c.10.2.0 (E:) automated matches {Sea lamprey (Petromyzon marinus) [TaxId: 7757]}
cpsqcscrgttvncdsrslasvpagiptdrqnlwlnnnqitklepgvfdsltaltflnvg
dnqlsalpigvfdrlaqltrlglshnqftalpagvfdklpklthlvlhtnqlksiprgaf
dnlkslthiylfnnpwdcecsdilylknwivqhasivnphpyggvdnvkcsgtntpvrav
teastspskcp

Timeline for d5wk4e_:

• d5wk4e_ is new in SCOPe 2.06-stable
  
• d5wk4e_ appears in SCOPe 2.07
  
• d5wk4e_ appears in the current release, SCOPe 2.08