Lineage for d5wk4d_ (5wk4 D:)

  1. Root: SCOPe 2.06
  2. 2089713Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2111496Fold c.10: Leucine-rich repeat, LRR (right-handed beta-alpha superhelix) [52046] (3 superfamilies)
    2 curved layers, a/b; parallel beta-sheet; order 1234...N; there are sequence similarities between different superfamilies
  4. 2111565Superfamily c.10.2: L domain-like [52058] (9 families) (S)
    less regular structure consisting of variable repeats
  5. 2111767Family c.10.2.0: automated matches [191489] (1 protein)
    not a true family
  6. 2111768Protein automated matches [190787] (11 species)
    not a true protein
  7. 2111824Species Sea lamprey (Petromyzon marinus) [TaxId:7757] [231246] (6 PDB entries)
  8. 2111829Domain d5wk4d_: 5wk4 D: [342920]
    automated match to d2o6ra_
    complexed with mg

Details for d5wk4d_

PDB Entry: 5wk4 (more details), 1.5 Å

PDB Description: crystal structure of an anti-idiotype vlr
PDB Compounds: (D:) Variable lymphocyte receptor 39

SCOPe Domain Sequences for d5wk4d_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5wk4d_ c.10.2.0 (D:) automated matches {Sea lamprey (Petromyzon marinus) [TaxId: 7757]}
ggcpsqcscrgttvncdsrslasvpagiptdrqnlwlnnnqitklepgvfdsltaltfln
vgdnqlsalpigvfdrlaqltrlglshnqftalpagvfdklpklthlvlhtnqlksiprg
afdnlkslthiylfnnpwdcecsdilylknwivqhasivnphpyggvdnvkcsgtntpvr
avteastspskc

SCOPe Domain Coordinates for d5wk4d_:

Click to download the PDB-style file with coordinates for d5wk4d_.
(The format of our PDB-style files is described here.)

Timeline for d5wk4d_: