| Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
| Fold c.10: Leucine-rich repeat, LRR (right-handed beta-alpha superhelix) [52046] (3 superfamilies) 2 curved layers, a/b; parallel beta-sheet; order 1234...N; there are sequence similarities between different superfamilies |
Superfamily c.10.2: L domain-like [52058] (9 families) ![]() less regular structure consisting of variable repeats |
| Family c.10.2.0: automated matches [191489] (1 protein) not a true family |
| Protein automated matches [190787] (11 species) not a true protein |
| Species Sea lamprey (Petromyzon marinus) [TaxId:7757] [231246] (6 PDB entries) |
| Domain d5wk4c_: 5wk4 C: [342937] automated match to d2o6ra_ complexed with mg |
PDB Entry: 5wk4 (more details), 1.5 Å
SCOPe Domain Sequences for d5wk4c_:
Sequence; same for both SEQRES and ATOM records: (download)
>d5wk4c_ c.10.2.0 (C:) automated matches {Sea lamprey (Petromyzon marinus) [TaxId: 7757]}
ggcpsqcscrgttvncdsrslasvpagiptdrqnlwlnnnqitklepgvfdsltaltfln
vgdnqlsalpigvfdrlaqltrlglshnqftalpagvfdklpklthlvlhtnqlksiprg
afdnlkslthiylfnnpwdcecsdilylknwivqhasivnphpyggvdnvkcsgtntpvr
avteastspskc
Timeline for d5wk4c_: