Lineage for d1dctb_ (1dct B:)
- Root: SCOPe 2.08
Class c: Alpha and beta proteins (a/b) [51349] (148 folds) 
Fold c.66: S-adenosyl-L-methionine-dependent methyltransferases [53334] (1 superfamily)
core: 3 layers, a/b/a; mixed beta-sheet of 7 strands, order 3214576; strand 7 is antiparallel to the restSuperfamily c.66.1: S-adenosyl-L-methionine-dependent methyltransferases [53335] (61 families) 
Family c.66.1.26: C5 cytosine-specific DNA methylase, DCM [88786] (5 proteins)
automatically mapped to Pfam PF00145
Protein DNA methylase HaeIII [53371] (1 species) Species Haemophilus aegyptius [TaxId:197575] [53372] (1 PDB entry) 
Domain d1dctb_: 1dct B: [34245]
protein/DNA complex; complexed with ca
Details for d1dctb_
PDB Entry: 1dct (more details), 2.8 Å
PDB Description: dna (cytosine-5) methylase from haeiii covalently bound to dna
PDB Compounds: (B:) protein (modification methylase haeiii)SCOPe Domain Sequences for d1dctb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1dctb_ c.66.1.26 (B:) DNA methylase HaeIII {Haemophilus aegyptius [TaxId: 197575]}
mnlislfsgaggldlgfqkagfriicaneydksiwktyesnhsaklikgdiskissdefp
kcdgiiggppcqswseggslrgiddprgklfyeyirilkqkkpifflaenvkgmmaqrhn
kavqefiqefdnagydvhiillnandygvaqdrkrvfyigfrkelninylppiphlikpt
fkdviwdlkdnpipaldknktngnkciypnheyfigsystifmsrnrvrqwnepaftvqa
sgrqcqlhpqapvmlkvsknlnkfvegkehlyrrltvrecarvqgfpddfifhyeslndg
ykmignavpvnlayeiaktiksal
SCOPe Domain Coordinates for d1dctb_:
Click to download the PDB-style file with coordinates for d1dctb_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1dctb_:
- d1dctb_ first appeared (with stable ids) in SCOP 1.55
- d1dctb_ appears in SCOPe 2.07
View in 3D
