PDB entry 1dct

View 1dct on RCSB PDB site
Description: DNA (cytosine-5) methylase from haeiii covalently bound to DNA
Class: transferase/DNA
Keywords: enzyme, cytosine methylase, transferase/DNA complex
Deposited on 1995-05-17, released 1995-09-15
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.8 Å
R-factor: 0.226
AEROSPACI score: 0.24 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: protein (modification methylase haeiii)
    Species: Haemophilus influenzae biotype aegyptius [TaxId:725]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1dcta_
  • Chain 'B':
    Compound: protein (modification methylase haeiii)
    Species: Haemophilus influenzae biotype aegyptius [TaxId:725]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1dctb_
  • Chain 'F':
    Compound: DNA (5'-d(*ap*cp*cp*ap*gp*cp*ap*gp*gp*(c49)p*cp*ap*cp*cp*ap*gp*tp*g)-3')
  • Chain 'G':
    Compound: DNA (5'-d(*ap*cp*cp*ap*gp*cp*ap*gp*gp*(c49)p*cp*ap*cp*cp*ap*gp*tp*g)-3')
  • Chain 'M':
    Compound: DNA (5'-d(*tp*cp*ap*cp*tp*gp*gp*tp*gp*gp*(c5m)p*cp*tp*gp*cp*tp*gp*g)-3')
  • Chain 'N':
    Compound: DNA (5'-d(*tp*cp*ap*cp*tp*gp*gp*tp*gp*gp*(c5m)p*cp*tp*gp*cp*tp*gp*g)-3')
  • Heterogens: CA

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1dctA (A:)
    mnlislfsgaggldlgfqkagfriicaneydksiwktyesnhsaklikgdiskissdefp
    kcdgiiggppcqswseggslrgiddprgklfyeyirilkqkkpifflaenvkgmmaqrhn
    kavqefiqefdnagydvhiillnandygvaqdrkrvfyigfrkelninylppiphlikpt
    fkdviwdlkdnpipaldknktngnkciypnheyfigsystifmsrnrvrqwnepaftvqa
    sgrqcqlhpqapvmlkvsknlnkfvegkehlyrrltvrecarvqgfpddfifhyeslndg
    ykmignavpvnlayeiaktiksal
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1dctB (B:)
    mnlislfsgaggldlgfqkagfriicaneydksiwktyesnhsaklikgdiskissdefp
    kcdgiiggppcqswseggslrgiddprgklfyeyirilkqkkpifflaenvkgmmaqrhn
    kavqefiqefdnagydvhiillnandygvaqdrkrvfyigfrkelninylppiphlikpt
    fkdviwdlkdnpipaldknktngnkciypnheyfigsystifmsrnrvrqwnepaftvqa
    sgrqcqlhpqapvmlkvsknlnkfvegkehlyrrltvrecarvqgfpddfifhyeslndg
    ykmignavpvnlayeiaktiksal
    

  • Chain 'F':
    No sequence available.

  • Chain 'G':
    No sequence available.

  • Chain 'M':
    No sequence available.

  • Chain 'N':
    No sequence available.