Class c: Alpha and beta proteins (a/b) [51349] (117 folds) |
Fold c.66: S-adenosyl-L-methionine-dependent methyltransferases [53334] (1 superfamily) core: 3 layers, a/b/a; mixed beta-sheet of 7 strands, order 3214576; strand 7 is antiparallel to the rest |
Superfamily c.66.1: S-adenosyl-L-methionine-dependent methyltransferases [53335] (23 families) |
Family c.66.1.10: DNA methylases [53366] (5 proteins) |
Protein DNA methylase HhaI, coenzyme-binding domain [53367] (1 species) |
Species Haemophilus haemolyticus [TaxId:726] [53368] (13 PDB entries) |
Domain d10mha_: 10mh A: [34232] protein/DNA complex; complexed with 5mc, 5nc, sah |
PDB Entry: 10mh (more details), 2.55 Å
SCOP Domain Sequences for d10mha_:
Sequence; same for both SEQRES and ATOM records: (download)
>d10mha_ c.66.1.10 (A:) DNA methylase HhaI, coenzyme-binding domain {Haemophilus haemolyticus} mieikdkqltglrfidlfaglggfrlalescgaecvysnewdkyaqevyemnfgekpegd itqvnektipdhdilcagfpcqafsisgkqkgfedsrgtlffdiarivrekkpkvvfmen vknfashdngntlevvkntmneldysfhakvlnaldygipqkreriymicfrndlniqnf qfpkpfelntfvkdlllpdsevehlvidrkdlvmtnqeieqttpktvrlgivgkggqger iystrgiaitlsaygggifaktggylvngktrklhprecarvmgypdsykvhpstsqayk qfgnsvvinvlqyiaynigsslnfkpy
Timeline for d10mha_: