Lineage for d10mha_ (10mh A:)
- Root: SCOP 1.55
Class c: Alpha and beta proteins (a/b) [51349] (97 folds) 
Fold c.66: S-adenosyl-L-methionine-dependent methyltransferases [53334] (1 superfamily) Superfamily c.66.1: S-adenosyl-L-methionine-dependent methyltransferases [53335] (11 families) 
Family c.66.1.10: DNA methylases [53366] (5 proteins) 
Protein DNA methylase HhaI, coenzyme-binding domain [53367] (1 species) Species Haemophilus haemolyticus [TaxId:726] [53368] (12 PDB entries) 
Domain d10mha_: 10mh A: [34232]
Details for d10mha_
PDB Entry: 10mh (more details), 2.55 Å
PDB Description: ternary structure of hhai methyltransferase with adohcy and hemimethylated dna containing 5,6-dihydro-5-azacytosine at the target
SCOP Domain Sequences for d10mha_:
Sequence; same for both SEQRES and ATOM records: (download)
>d10mha_ c.66.1.10 (A:) DNA methylase HhaI, coenzyme-binding domain {Haemophilus haemolyticus}
mieikdkqltglrfidlfaglggfrlalescgaecvysnewdkyaqevyemnfgekpegd
itqvnektipdhdilcagfpcqafsisgkqkgfedsrgtlffdiarivrekkpkvvfmen
vknfashdngntlevvkntmneldysfhakvlnaldygipqkreriymicfrndlniqnf
qfpkpfelntfvkdlllpdsevehlvidrkdlvmtnqeieqttpktvrlgivgkggqger
iystrgiaitlsaygggifaktggylvngktrklhprecarvmgypdsykvhpstsqayk
qfgnsvvinvlqyiaynigsslnfkpy
SCOP Domain Coordinates for d10mha_:
Click to download the PDB-style file with coordinates for d10mha_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d10mha_:
- d10mha_ appears in SCOP 1.57
- d10mha_ appears in the current release, SCOPe 2.08
View in 3D