Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.80: SIS domain [53696] (1 superfamily) 3 layers: a/b/a; parallel beta-sheet of 5 strands, order 21345 |
Superfamily c.80.1: SIS domain [53697] (4 families) |
Family c.80.1.0: automated matches [191405] (1 protein) not a true family |
Protein automated matches [190547] (16 species) not a true protein |
Species Burkholderia pseudomallei [TaxId:28450] [342290] (1 PDB entry) |
Domain d5lu6d_: 5lu6 D: [342296] automated match to d3bjzd_ complexed with edo, gol, i22, pge; mutant |
PDB Entry: 5lu6 (more details), 1.67 Å
SCOPe Domain Sequences for d5lu6d_:
Sequence; same for both SEQRES and ATOM records: (download)
>d5lu6d_ c.80.1.0 (D:) automated matches {Burkholderia pseudomallei [TaxId: 28450]} nreltyitnsiaeaqrvmaamladerllatvrkvadaciasiaqggkvllagnggsaada qqiagefvsrfafdrpglpavalttdtsiltaigndygyeklfsrqvqalgnegdvligy stsgkspnilaafreakakgmtcvgftgnrggemrelcdlllevpsadtpkiqeghlvlg hivcglvehsifgk
Timeline for d5lu6d_: