Lineage for d5lu6d_ (5lu6 D:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2908082Fold c.80: SIS domain [53696] (1 superfamily)
    3 layers: a/b/a; parallel beta-sheet of 5 strands, order 21345
  4. 2908083Superfamily c.80.1: SIS domain [53697] (4 families) (S)
  5. 2908303Family c.80.1.0: automated matches [191405] (1 protein)
    not a true family
  6. 2908304Protein automated matches [190547] (18 species)
    not a true protein
  7. 2908335Species Burkholderia pseudomallei [TaxId:28450] [342290] (1 PDB entry)
  8. 2908339Domain d5lu6d_: 5lu6 D: [342296]
    automated match to d3bjzd_
    complexed with edo, gol, i22, pge; mutant

Details for d5lu6d_

PDB Entry: 5lu6 (more details), 1.67 Å

PDB Description: heptose isomerase mutant - h64q
PDB Compounds: (D:) Phosphoheptose isomerase

SCOPe Domain Sequences for d5lu6d_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5lu6d_ c.80.1.0 (D:) automated matches {Burkholderia pseudomallei [TaxId: 28450]}
nreltyitnsiaeaqrvmaamladerllatvrkvadaciasiaqggkvllagnggsaada
qqiagefvsrfafdrpglpavalttdtsiltaigndygyeklfsrqvqalgnegdvligy
stsgkspnilaafreakakgmtcvgftgnrggemrelcdlllevpsadtpkiqeghlvlg
hivcglvehsifgk

SCOPe Domain Coordinates for d5lu6d_:

Click to download the PDB-style file with coordinates for d5lu6d_.
(The format of our PDB-style files is described here.)

Timeline for d5lu6d_: