Lineage for d5wkph_ (5wkp H:)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2240027Fold d.224: SufE/NifU [82648] (1 superfamily)
    alpha(2)-beta(3)-alpha(3); 2 layers alpha/beta, 3-stranded antiparallel beta-sheet; order 123
  4. 2240028Superfamily d.224.1: SufE/NifU [82649] (4 families) (S)
    iron-sulfur cluster assembly proteins
  5. 2240053Family d.224.1.2: NifU/IscU domain [102928] (5 proteins)
  6. 2240068Protein automated matches [254586] (5 species)
    not a true protein
  7. 2240078Species Homo sapiens [TaxId:9606] [341681] (1 PDB entry)
  8. 2240080Domain d5wkph_: 5wkp H: [341691]
    Other proteins in same PDB: d5wkpa1, d5wkpa2, d5wkpc_, d5wkpe1, d5wkpe2, d5wkpg_
    automated match to d2l4xa_
    complexed with 8q1, plp

Details for d5wkph_

PDB Entry: 5wkp (more details), 3.15 Å

PDB Description: crystal structure of the human mitochondrial cysteine desulfurase in complex with isd11 and iron-sulfur cluster scaffold protein iscu1, and e. coli acp1 protein at 3.15a
PDB Compounds: (H:) Iron-sulfur cluster assembly enzyme ISCU, mitochondrial

SCOPe Domain Sequences for d5wkph_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5wkph_ d.224.1.2 (H:) automated matches {Homo sapiens [TaxId: 9606]}
lstqvvdhyenprnvgsldktsknvgtglvgapacgdvmklqiqvdekgkivdarfktfg
cgsaiassslatewvkgktveealtikntdiakelclppvklhcsilaedaikaaladyk
lkqepk

SCOPe Domain Coordinates for d5wkph_:

Click to download the PDB-style file with coordinates for d5wkph_.
(The format of our PDB-style files is described here.)

Timeline for d5wkph_: