SCOPe 2.06: Domain d5wkpg_: 5wkp G:

Lineage for d5wkpg_ (5wkp G:)

1. Root: SCOPe 2.06

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.28: Acyl carrier protein-like [47335] (3 superfamilies)
   4 helices, bundle; helix 3 is shorter than others; up-and-down

4. Superfamily a.28.1: ACP-like [47336] (4 families)

5. Family a.28.1.1: Acyl-carrier protein (ACP) [47337] (7 proteins)

6. Protein Acyl carrier protein [47338] (7 species)

7. Species Escherichia coli [TaxId:562] [47339] (15 PDB entries)
   Uniprot P02901

8. Domain d5wkpg_: 5wkp G: [341702]
   Other proteins in same PDB: d5wkpa1, d5wkpa2, d5wkpd_, d5wkpe1, d5wkpe2, d5wkph_
   automated match to d1t8ka_
   complexed with 8q1, plp

Details for d5wkpg_

PDB Entry: 5wkp, 3.15 Å

PDB Description: crystal structure of the human mitochondrial cysteine desulfurase in complex with isd11 and iron-sulfur cluster scaffold protein iscu1, and e. coli acp1 protein at 3.15a

PDB Compounds: (G:) Acyl carrier protein

SCOPe Domain Sequences for d5wkpg_:

Sequence; same for both SEQRES and ATOM records:

>d5wkpg_ a.28.1.1 (G:) Acyl carrier protein {Escherichia coli [TaxId: 562]}
ieervkkiigeqlgvkqeevtnnasfvedlgadsldtvelvmaleeefdteipdeeaeki
ttvqaaidyin

Timeline for d5wkpg_:

• d5wkpg_ is new in SCOPe 2.06-stable
  
• d5wkpg_ appears in SCOPe 2.07
  
• d5wkpg_ appears in the current release, SCOPe 2.08